[KD Validated] FOSL1 Rabbit polyclonal antibody

Size

POA

SKU:: A21988
Additional Names:: [KD Validated] FOSL1|FRA|fra-1|FRA1
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
Uniprot:: P15407
Synonyms:: FOS like 1, AP-1 trancription factor subunit;FOS-like antigen-1;fos-related antigen 1;FRA;fra-1;FRA1
Extra Details:: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.