A21987
TLK1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21987
- Additional Names:
- PKU-beta|TLK1
- Application:
- ELISA, WB
- Molecular Weight:
- 87kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLR
- Uniprot:
- Q9UKI8
- Synonyms:
- PKU-beta;serine threonine protein kinase;serine/threonine-protein kinase tousled-like 1;SNARE protein kinase SNAK;Tousled-like kinase 1
- Extra Details:
- The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

