DRP1 Rabbit monoclonal antibody

Size

POA

SKU:: A21968
Additional Names:: DLP1|DRP1|DVLP|DYMPLE|EMPF|EMPF1|HDYNIV|OPA5
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 78kDa/82kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAV
Uniprot:: O00429
Synonyms:: DLP1;Dnm1p/Vps1p-like protein;DRP1;DVLP;DYMPLE;dynamin family member proline-rich carboxyl-terminal domain less;dynamin-1-like protein;Dynamin-like protein;dynamin-like protein 4;dynamin-like protein IV;dynamin-related protein 1;EMPF;EMPF1;HDYNIV;OPA5
Extra Details:: This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms.