TIFY10A Rabbit polyclonal antibody

Size

POA

SKU:: A21960
Additional Names:: AtJAZ1|jasmonate-zim-domain protein 1|T29M8_5|T29M8.5|TIFY10A
Application:: ELISA, WB
Molecular Weight:: 32kDa
Species Reactivity:: Plant
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Plant
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI
Uniprot:: Q9LMA8
Synonyms:: AT1G19180;AtJAZ1;Jasmonate ZIM domain-containing protein 1;jasmonate-zim-domain protein 1;T29M8_5;T29M8.5;TIFY10A
Extra Details:: JAZ1 is a nuclear-localized protein involved in jasmonate signaling. JAZ1 transcript levels rise in response to a jasmonate stimulus. JAZ1 can interact with the COI1 F-box subunit of an SCF E3 ubiquitin ligase in a yeast-two-hybrid assay only in the presence of jasmonate-isoleucine (JA-ILE) or coronatine. Application of jasmonate methyl ester to Arabidopsis roots reduces the levels of a JAZ1:GUS fusion protein, presumably by stimulating ubiquitin-proteasome-mediated degradation. The Jas domain appears to be important for JAZ1-COI1 interactions in the presence of coronatine. Two positive residues (R205 and R206) in the Jas domain shown to be important for coronatine -dependent COI1 binding are not required for binding AtMYC2.