A2191
SELE Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2191
- Additional Names:
- CD62E|ELAM|ELAM1|ESEL|LECAM2|SELE|selectin-e
- Application:
- ELISA, WB
- Molecular Weight:
- 67kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEW
- Uniprot:
- P16581
- Synonyms:
- CD62 antigen-like family member E;CD62E;E-selectin;ELAM;ELAM-1;ELAM1;endothelial adhesion molecule 1;endothelial leukocyte adhesion molecule 1;ESEL;LECAM2;leukocyte endothelial cell adhesion molecule 2;Leukocyte-endothelial cell adhesion molecule 2
- Extra Details:
- The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.
- Shipping Conditions:
- Blue Ice

