NLRP3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21906
Additional Names:: AGTAVPRL|AII/AVP|Cias1|FCAS|FCU|Mmig1|MWS|NALP3|NLRP3|Pypaf1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 110kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWN
Uniprot:: Q8R4B8
Synonyms:: AGTAVPRL;AII/AVP;Ci;Cias1;cold autoinflammatory syndrome 1 protein homolog;cry;cryopyrin;FCAS;FCU;mast cell maturation-associated-inducible protein 1;Mmig;Mmig1;MWS;N;NACHT, LRR and PYD domains-containing protein 3;NACHT/LRR/pyrin domain-containing protein 3;NALP3;Pyp;Pypaf1;PYRIN-containing APAF1-like protein 1
Extra Details:: Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).

Shipping Conditions:: Blue Ice