A2190
p70 S6 Kinase 1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2190
- Additional Names:
- p70 S6 Kinase 1|p70 S6KA|p70-alpha|p70-S6K|p70(S6K)-alpha|PS6K|S6K|S6K-beta-1|S6K1|STK14A
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEH
- Uniprot:
- P23443
- Synonyms:
- 70 kDa ribosomal protein S6 kinase 1;p70 ribosomal S6 kinase alpha;p70 S6KA;p70-alpha;p70-S6K;p70(S6K)-alpha;PS6K;ribosomal protein S6 kinase beta-1;ribosomal protein S6 kinase I;ribosomal protein S6 kinase, 70kDa, polypeptide 1;S6K;S6K-beta-1;S6K1;serine/threonine kinase 14 alpha;serine/threonine-protein kinase 14A;STK14A
- Extra Details:
- This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.
- Shipping Conditions:
- Blue Ice