MST1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21842
Additional Names:: KRS2|MST1|STK4|YSK3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 56kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
Uniprot:: Q13043
Synonyms:: hippo homolog;kinase responsive to stress 2;KRS2;mammalian STE20-like protein kinase 1;mammalian sterile 20-like 1;MST1;serine/threonine-protein kinase 4;serine/threonine-protein kinase Krs-2;STE20-like kinase MST1;YSK3
Extra Details:: The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.

Shipping Conditions:: Blue Ice