A21830
FUS Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21830
- Additional Names:
- ALS6|altFUS|ETM4|FUS|FUS1|HNRNPP2|POMP75|TLS
- Application:
- ELISA, WB, IHC-P, IP
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
- Uniprot:
- P35637
- Synonyms:
- 75 kDa DNA-pairing protein;ALS6;altFUS;ETM4;fus-like protein;FUS1;fused in sarcoma;fusion gene in myxoid liposarcoma;heterogeneous nuclear ribonucleoprotein P2;HNRNPP2;oncogene FUS;oncogene TLS;POMP75;RNA-binding protein FUS;TLS;translocated in liposarcoma protein
- Extra Details:
- This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
- Shipping Conditions:
- Blue Ice