A21827
SIRT5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21827
- Additional Names:
- SIR2L5|SIRT5
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
- Uniprot:
- Q9NXA8
- Synonyms:
- NAD-dependent deacetylase sirtuin-5;NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial;NAD-dependent protein deacylase sirtuin-5, mitochondrial;Regulatory protein SIR2 homolog 5;silent mating type information regulation 2, S.cerevisiae, homolog 5;sir2-like 5;SIR2-like protein 5;SIR2L5;sirtuin type 5
- Extra Details:
- This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

