PLC gamma 2 (PLCG2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A2182
Additional Names:: APLAID|FCAS3|PLC gamma 2 (PLCG2)|PLC-gamma-2|PLC-IV
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 175kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
Uniprot:: P16885
Synonyms:: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2;APLAID;FCAS3;phosphoinositide phospholipase C-gamma-2;Phospholipase C-gamma-2;phospholipase C-IV;phospholipase C, gamma 2 (phosphatidylinositol-specific);PLC-gamma-2;PLC-IV
Extra Details:: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.

Shipping Conditions:: Blue Ice