AMPKA Alpha1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21813
Additional Names:: AMPK|AMPK alpha 1|AMPKa1|AMPKA Alpha1
Application:: ELISA, WB
Molecular Weight:: 64kDa
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRL
Uniprot:: Q13131
Synonyms:: 5'-AMP-activated protein kinase catalytic subunit alpha-1;5'-AMP-activated protein kinase, catalytic alpha-1 chain;ACACA kinase;acetyl-CoA carboxylase kinase;AMP -activate kinase alpha 1 subunit;AMP-activated protein kinase, catalytic, alpha-1;AMPK;AMPK alpha 1;AMPK subunit alpha-1;AMPK, alpha, 1;AMPKa1;HMGCR kinase;hydroxymethylglutaryl-CoA reductase kinase;protein kinase, AMP-activated, alpha 1 catalytic subunit;tau-protein kinase PRKAA1
Extra Details:: The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Shipping Conditions:: Blue Ice