A21807
SEC61B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21807
- Additional Names:
- Sec61 translocon beta subunit|SEC61B
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
- Uniprot:
- P60468
- Synonyms:
- protein translocation complex beta;protein transport protein SEC61 beta subunit;protein transport protein Sec61 subunit beta;Sec61 beta subunit;Sec61 complex, beta subunit;SEC61 translocon beta subunit
- Extra Details:
- The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.
- Shipping Conditions:
- Blue Ice







