KDM1A Rabbit polyclonal antibody

Size

£152.00

SKU:: A21801
Additional Names:: AOF2|BHC110|CPRF|KDM1|KDM1A|LSD1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ
Uniprot:: O60341
Synonyms:: [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A;amine oxidase (flavin containing) domain 2;AOF2;BHC110;BRAF35-HDAC complex protein BHC110;CPRF;FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit;flavin-containing amine oxidase domain-containing protein 2;KDM1;LSD1;lysine (K)-specific demethylase 1A;lysine-specific histone demethylase 1;lysine-specific histone demethylase 1A
Extra Details:: This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice