A21800
MAP1LC3B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21800
- Additional Names:
- 3B|ATG8F|LC3B|MAP1A/1BLC3|MAP1LC3B-a
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa,16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKT
- Uniprot:
- Q9GZQ8
- Synonyms:
- ATG8F;Autophagy-related protein LC3 B;autophagy-related ubiquitin-like modifier LC3 B;LC3B;MAP1 light chain 3-like protein 2;MAP1A/1BLC3;MAP1A/MAP1B LC3 B;MAP1A/MAP1B light chain 3 B;MAP1LC3B-a;Microtubule-associated protein 1 light chain 3 beta;microtubule-associated proteins 1A/1B light chain 3B
- Extra Details:
- The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
- Shipping Conditions:
- Blue Ice