A2179
BNP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2179
- Additional Names:
- BNP|Iso-ANP
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 15 kDa/22 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Uniprot:
- P16860
- Synonyms:
- BNP;brain natriuretic factor prohormone;brain type natriuretic peptide;gamma-brain natriuretic peptide;Iso-ANP;natriuretic peptide precursor B;natriuretic peptides B;natriuretic protein;preproBNP;proBNP
- Extra Details:
- This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The presence of myocardial injury is a significant predictor of mortality in hospitalized coronavirus disease 2019 (COVID-19) patients, and there is evidence of increased levels of natriuretic peptide B in hospitalized non-survivor COVID-19 patients. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis.
- Shipping Conditions:
- Blue Ice