A21785
[KD Validated] RARG Rabbit polyclonal antibody

Size
POA
- SKU:
- A21785
- Additional Names:
- [KD Validated] RARG|NR1B3|RARC|RARgamma
- Application:
- ELISA, WB
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS
- Uniprot:
- P13631
- Synonyms:
- NR1B3;nuclear receptor subfamily 1 group B member 3;RAR-gamma;RARC;retinoic acid nuclear receptor gamma variant 1;retinoic acid nuclear receptor gamma variant 2;retinoic acid receptor gamma
- Extra Details:
- This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice
![[KD Validated] RARG Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21785/A21785_1.jpg)
![[KD Validated] RARG Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21785/A21785_2.jpg)
![[KD Validated] RARG Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21785/A21785_N16536-4_WB_01.jpg)
![[KD Validated] RARG Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21785/A21785_N16536-4_KO-WB_01.jpg)