A2176
Stathmin 1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2176
- Additional Names:
- C1orf215|Lag|LAP18|OP18|PP17|PP19|PR22|SMN|Stathmin 1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
- Uniprot:
- P16949
- Synonyms:
- C1orf215;Lag;LAP18;leukemia-associated phosphoprotein p18;metablastin;oncoprotein 18;OP18;phosphoprotein 19;phosphoprotein p19;PP17;PP19;PR22;prosolin;Protein Pr22;SMN;stathmin;stathmin 1/oncoprotein 18;testicular tissue protein Li 189;transmembrane protein C1orf215
- Extra Details:
- This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice