A21755
Raptor Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21755
- Additional Names:
- KOG1|Mip1|Raptor
- Application:
- ELISA, WB
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
- Uniprot:
- Q8N122
- Synonyms:
- KOG1;Mip1;p150 target of rapamycin (TOR)-scaffold protein;p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats;raptor;regulatory-associated protein of mTOR
- Extra Details:
- This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

