CD18 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2173
Additional Names:: CD18|LAD|LCAMB|LFA-1|MAC-1|MF17|MFI7
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 95kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGY
Uniprot:: P05107
Synonyms:: CD18;cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor);Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta;complement component 3 receptor 3 and 4 subunit;complement receptor C3 beta-subunit;Complement receptor C3 subunit beta;integrin beta chain, beta 2;integrin beta-2;integrin, beta 2 (complement component 3 receptor 3 and 4 subunit);LAD;LCAMB;leukocyte cell adhesion molecule CD18;leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C;LFA-1;MAC-1;MF17;MFI7;truncated integrin beta-2
Extra Details:: This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice