A21707
STRADA Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21707
- Additional Names:
- LYK5|NY-BR-96|PMSE|Stlk|STRAD|STRAD alpha|STRADA
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPE
- Uniprot:
- Q7RTN6
- Synonyms:
- LYK5;NY-BR-96;PMSE;protein kinase LYK5;serologically defined breast cancer antigen NY-BR-96;STE20-like pseudokinase;STE20-related adapter protein;STE20-related kinase adapter protein alpha;STE20-related kinase adaptor alpha;Stlk;STRAD;STRAD alpha
- Extra Details:
- The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known.
- Shipping Conditions:
- Blue Ice