A2168
HLA-DQA1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2168
- Additional Names:
- CELIAC1|DQ-A1|DQA1|HLA-DQA|HLA-DQA1|HLA-DQA1*|HLA-DQB1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 28kDaa-37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELT
- Uniprot:
- P01909
- Synonyms:
- CELIAC1;DC-1 alpha chain;DC-alpha;DQ-A1;DQA1;HLA class II histocompatibility antigen DQ alpha chain;HLA class II histocompatibility antigen, DQ alpha 1 chain;HLA-DCA;HLA-DQA;MHC class II antigen DQA1;MHC class II DQ alpha chain;MHC class II DQA1;MHC class II HLA-DQ-alpha-1;MHC class II protein;MHC HLA-DQ alpha;truncated MHC class II antigen
- Extra Details:
- HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.
- Shipping Conditions:
- Blue Ice





