A21664
CDK2AP1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21664
- Additional Names:
- CDK2AP1|doc-1|DOC1|DORC1|p12DOC-1|ST19
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
- Uniprot:
- O14519
- Synonyms:
- CDK2-associated protein 1;cyclin-dependent kinase 2-associated protein 1;deleted in oral cancer 1;Deleted in oral cancer-1;doc-1;DOC1;DORC1;p12DOC-1;putative oral cancer suppressor;ST19
- Extra Details:
- The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice