USP4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21644
Additional Names:: UNP|Unph|USP4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 108kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ
Uniprot:: Q13107
Synonyms:: deubiquitinating enzyme 4;ubiquitin carboxyl-terminal esterase 4;ubiquitin carboxyl-terminal hydrolase 4;ubiquitin specific peptidase 4 (proto-oncogene);ubiquitin specific protease 4 (proto-oncogene);ubiquitin thioesterase 4;ubiquitin thiolesterase 4;ubiquitin-specific processing protease 4;Ubiquitin-specific-processing protease 4;ubiquitous nuclear protein homolog;UNP;Unph
Extra Details:: The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.