A21633
TP53BP2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21633
- Additional Names:
- 53BP2|ASPP2|BBP|P53BP2|PPP1R13A|TP53BP2
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKEN
- Uniprot:
- Q13625
- Synonyms:
- 53BP2;apoptosis-stimulating of p53 protein 2;apoptosis-stimulating protein of p53, 2;ASPP2;BBP;BCL2-binding protein;P53BP2;PPP1R13A;renal carcinoma antigen NY-REN-51;tumor suppressor p53-binding protein 2
- Extra Details:
- This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice



