A2163
Connexin 43 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2163
- Additional Names:
- AVSD3|CMDR|Connexin 43|CX43|EKVP|EKVP3|GJAL|HLHS1|HSS|ODDD|PPKCA
- Application:
- ELISA, WB
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
- Uniprot:
- P17302
- Synonyms:
- AVSD3;CMDR;connexin-43;CX43;EKVP;EKVP3;gap junction 43 kDa heart protein;gap junction alpha-1 protein;gap junction protein, alpha 1, 43kDa;GJAL;HLHS1;HSS;ODDD;PPKCA
- Extra Details:
- This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations.
- Shipping Conditions:
- Blue Ice



