METTL3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21572
Additional Names:: hMETTL3|IME4|M6A|METTL3|MT-A70|Spo8
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM
Uniprot:: Q86U44
Synonyms:: adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase;hMETTL3;IME4;M6A;methyltransferase like 3;methyltransferase-like protein 3;mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase;mRNA m(6)A methyltransferase;MT-A70;N6-adenosine-methyltransferase 70 kDa subunit;N6-adenosine-methyltransferase catalytic subunit;Spo8
Extra Details:: This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.