A21555
Cyclophilin 40 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21555
- Additional Names:
- Cyclophilin 40|CYP-40|CYPD
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
- Uniprot:
- Q08752
- Synonyms:
- 40 kDa peptidyl-prolyl cis-trans isomerase;40 kDa peptidyl-prolyl cis-trans isomerase D;cyclophilin 40;cyclophilin D;Cyclophilin-40;cyclophilin-related protein;CYP-40;CYPD;peptidyl-prolyl cis-trans isomerase D;PPIase D;rotamase D;testicular tissue protein Li 147
- Extra Details:
- The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.
- Shipping Conditions:
- Blue Ice







