PIK3C2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A21543
Additional Names:: CPK|OCSKD|PI3-K-C2(ALPHA)|PI3-K-C2A|PI3K-C2-alpha|PI3K-C2alpha|PIK3C2A
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPL
Uniprot:: O00443
Synonyms:: C2-containing phosphatidylinositol kinase;CPK;OCSKD;phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha;phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha;phosphoinositide 3-kinase-C2-alpha;phosphoinositide-3-kinase, class 2, alpha polypeptide;PI3-K-C2(ALPHA);PI3-K-C2A;PI3K-C2-alpha;PI3K-C2alpha;ptdIns-3-kinase C2 subunit alpha
Extra Details:: The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.

Shipping Conditions:: Blue Ice