A2152
KBTBD3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2152
- Additional Names:
- 2200003A07Rik|Bklhd3|KBTBD3
- Application:
- ELISA, WB
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF
- Synonyms:
- 2200003A07Rik;Bklhd;Bklhd3;BTB and kelch domain containing 3;BTB and kelch domain-containing protein 3;epididymis secretory sperm binding protein;kelch repeat and BTB (POZ) domain containing 3;kelch repeat and BTB domain-containing protein 3
- Extra Details:
- Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and tooth. Orthologous to human KBTBD3 (kelch repeat and BTB domain containing 3).
- Shipping Conditions:
- Blue Ice