OCRL Rabbit polyclonal antibody

Size

£152.00

SKU:: A21519
Additional Names:: Dent-2|DENT2|INPP5F|LOCR|NPHL2|OCRL|OCRL-1|OCRL1
Application:: ELISA, WB
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQRE
Uniprot:: Q01968
Synonyms:: Dent-2;DENT2;inositol polyphosphate 5-phosphatase OCRL;inositol polyphosphate 5-phosphatase OCRL-1;INPP5F;LOCR;Lowe oculocerebrorenal syndrome protein;NPHL2;OCRL-1;OCRL1;oculocerebrorenal syndrome of Lowe;phosphatidylinositol 3,4,5-triphosphate 5-phosphatase;phosphatidylinositol polyphosphate 5-phosphatase
Extra Details:: This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice