[KD Validated] NDUFS5 Rabbit polyclonal antibody

Size

POA

SKU:: A21504
Additional Names:: [KD Validated] NDUFS5|CI-15k|CI15K
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 13kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Uniprot:: O43920
Synonyms:: CI-15 kDa;CI-15k;CI15K;complex I-15 kDa;NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 5;NADH-ubiquinone oxidoreductase 15 kDa subunit;NADH:ubiquinone oxidoreductase 15 kDa IP subunit
Extra Details:: This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.