PIWIL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2150
Additional Names:: MIWI|PIWIL1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 90kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTGRARARARGRARGQETVQHVGAAASQQPGYIPPRPQQSPTEGDLVGRGRQRGMVVGATSKSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGR
Uniprot:: Q9JMB7
Synonyms:: CT80.1;HIWI;MI;MIWI;PIWI;piwi homolog;piwi-like homolog 1;piwi-like protein 1
Extra Details:: Enables several functions, including RNA binding activity; mRNA cap binding complex binding activity; and polysome binding activity. Involved in negative regulation of transposition; piRNA metabolic process; and spermatogenesis, exchange of chromosomal proteins. Located in chromatoid body; dense body; and nucleus. Is expressed in genitourinary system. Orthologous to human PIWIL1 (piwi like RNA-mediated gene silencing 1).