MTAP Rabbit polyclonal antibody

Size

£152.00

SKU:: A21496
Additional Names:: BDMF|c86fus|DMSFH|DMSMFH|HEL-249|LGMBF|MSAP|MTAP
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Uniprot:: Q13126
Synonyms:: 5'-methylthioadenosine phosphorylase;BDMF;c86fus;DMSFH;DMSMFH;epididymis luminal protein 249;epididymis secretory sperm binding protein;HEL-249;LGMBF;MeSAdo phosphorylase;MSAP;MTA phosphorylase;MTAPase;S-methyl-5'-thioadenosine phosphorylase
Extra Details:: This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.