Placental alkaline phosphatase (PLAP) Rabbit polyclonal antibody

Size

£152.00

SKU:: A21424
Additional Names:: ALP|ALPI|IAP|PALP|Placental alkaline phosphatase (PLAP)|PLAP|PLAP-1
Application:: ELISA, WB, IP
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Uniprot:: P05187
Synonyms:: alkaline phosphatase Regan isozyme;alkaline phosphatase, placental type;alkaline phosphomonoesterase;ALP;ALPI;glycerophosphatase;IAP;Intestinal alkaline phosphatase;Intestinal-type alkaline phosphatase;PALP;placental alkaline phosphatase 1;PLAP;PLAP-1
Extra Details:: The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.

Shipping Conditions:: Blue Ice