[KO Validated] NDRG1 Rabbit polyclonal antibody

Size

POA

SKU:: A2142
Additional Names:: CAP43|CMT4D|DRG-1|DRG1|G1|GC4|HMSNL|NDR1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: WAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Uniprot:: Q92597
Synonyms:: CAP43;CMT4D;differentiation-related gene 1 protein;DRG-1;DRG1;GC4;HMSNL;N-myc downstream-regulated gene 1 protein;NDR1;nickel-specific induction protein Cap43;NMSL;protein NDRG1;protein regulated by oxygen-1;PROXY1;reducing agents and tunicamycin-responsive protein;RIT42;RTP;TARG1;TDD5
Extra Details:: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Shipping Conditions:: Blue Ice