FKBP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21404
Additional Names:: FKBP-13|FKBP13|FKBP2|PPIase
Application:: ELISA, WB
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Uniprot:: P26885
Synonyms:: 13 kDa FK506-binding protein;13 kDa FKBP;epididymis secretory sperm binding protein;FK506 binding protein 2, 13kDa;FK506-binding protein 2;FKBP-13;FKBP13;immunophilin FKBP13;peptidyl-prolyl cis-trans isomerase FKBP2;PPIase;PPIase FKBP2;proline isomerase;rapamycin-binding protein;rotamase
Extra Details:: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.