[KO Validated] FH Rabbit polyclonal antibody

Size

POA

SKU:: A21403
Additional Names:: FH|FMRD|HLRCC|HsFH|LRCC|MCL|MCUL1
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTN
Uniprot:: P07954
Synonyms:: epididymis secretory sperm binding protein;FMRD;fumarase;fumarate hydratase, mitochondrial;HLRCC;HsFH;LRCC;MCL;MCUL1
Extra Details:: The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.