A21399
Lrwd1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21399
- Additional Names:
- CENP-33|Lrwd1|ORCA
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL
- Uniprot:
- Q9UFC0
- Synonyms:
- CENP-33;centromere protein 33;leucine-rich repeat and WD repeat-containing protein 1;ORC-associated protein;ORCA;origin recognition complex-associated protein;testicular tissue protein Li 4
- Extra Details:
- The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is required for the G1/S phase transition of the cell cycle. In addition, the encoded protein binds to trimethylated histone H3 in heterochromatin and recruits the ORC and lysine methyltransferases, which help maintain the repressive heterochromatic state. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

