A2138
TNFSF10 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2138
- Additional Names:
- Apo-2L|APO2L|CD253|TANCR|TL2|TNFSF10|TNLG6A|TRAIL
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETI
- Uniprot:
- P50591
- Synonyms:
- Apo-2 ligand;Apo-2L;APO2L;CD253;chemokine tumor necrosis factor ligand superfamily member 10;TL2;TNF-related apoptosis inducing ligand TRAIL;TNF-related apoptosis-inducing ligand;TNLG6A;TRAIL;tumor necrosis factor (ligand) family, member 10;tumor necrosis factor (ligand) superfamily, member 10;tumor necrosis factor apoptosis-inducing ligand splice variant delta;tumor necrosis factor ligand 6A;tumor necrosis factor ligand superfamily member 10;tumor necrosis factor superfamily member 10
- Extra Details:
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

