A21371
D Delta-Catenin/p120 Catenin Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21371
- Additional Names:
- BCDS2|CAS|CTNND|p120|p120(CAS)|p120(CTN)|P120CAS|P120CTN|D Delta-Catenin/p120 Catenin
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQKI
- Uniprot:
- O60716
- Synonyms:
- BCDS2;cadherin-associated Src substrate;CAS;catenin (cadherin-associated protein), delta 1;catenin delta-1;CTNND;p120;p120 catenin;p120(CAS);p120(CTN);P120CAS;P120CTN
- Extra Details:
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.
- Shipping Conditions:
- Blue Ice