MYL6B Rabbit polyclonal antibody

Size

£152.00

SKU:: A21363
Additional Names:: MLC1SA|MYL6B
Application:: ELISA, WB
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Uniprot:: P14649
Synonyms:: MLC1SA;myosin alkali light chain 1 slow a;myosin light chain 1 slow a;Myosin light chain 1 slow-twitch muscle A isoform;myosin light chain 6B;myosin, light chain 6B, alkali, smooth muscle and non-muscle;myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle;smooth muscle and non-muscle myosin alkali light chain 6B;smooth muscle and nonmuscle myosin light chain alkali 6B
Extra Details:: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.