A21361
CPS1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21361
- Additional Names:
- CPS1|CPSASE1|GATD6|PHN
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 165kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESMTEETLKRAKEIGFSDKQISKCLGLT
- Uniprot:
- P31327
- Synonyms:
- carbamoyl-phosphate synthase (ammonia);carbamoyl-phosphate synthase [ammonia], mitochondrial;carbamoyl-phosphate synthase 1, mitochondrial;Carbamoyl-phosphate synthetase I;carbamoylphosphate synthetase I;CPSASE1;GATD6;PHN
- Extra Details:
- The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.
- Shipping Conditions:
- Blue Ice



