ARMC10 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21304
Additional Names:: ARMC10|PNAS-112|PNAS112|PSEC0198|SVH
Application:: ELISA, WB
Molecular Weight:: 31-37kd
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: TNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI
Uniprot:: Q8N2F6
Synonyms:: armadillo repeat-containing protein 10;PNAS-112;PNAS112;PSEC0198;specific splicing variant involved in hepatocarcinogenesis;splicing variant involved in hepatocarcinogenesis protein;SVH
Extra Details:: This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3.