A21301
CD117 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A21301
- Additional Names:
- Bs|c-KIT|CD117|Fdc|Gsfsco1|Gsfsco5|Gsfsow3|SCO1|SCO5|SOW3|Ssm|Tr-kit|W
- Application:
- ELISA, WB
- Molecular Weight:
- 145KD
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
- Uniprot:
- P05532
- Synonyms:
- belly;belly-spot;Bs;c-KI;c-KIT;c-kit proto-oncogene protein;CD117;dominant spotting;Dominant white spotting;Fdc;Gsfs;Gsfsco1;Gsfsco5;Gsfsow3;kit oncogene;mast/stem cell growth factor receptor Kit;proto-oncogene c-Kit;proto-oncogene tyrosine-protein kinase Kit;SC;SCFR;SCO1;SCO5;SO;SOW3;spotted sterile male;Ssm;Steel Factor Receptor;Tr-k;Tr-kit;tyrosine-protein kinase Kit;W
- Extra Details:
- The c-Kit proto-oncogene is the cellular homolog of the transforming gene of a feline retrovirus (v-Kit). The c-kit protein includes characteristics of a protein kinase transmembrane receptor. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice