A2130
SUMO1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2130
- Additional Names:
- DAP1|GMP1|OFC10|PIC1|SENP2|SMT3|SMT3C|SMT3H3|SUMO1|UBL1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 17kDa/80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
- Uniprot:
- P63165
- Synonyms:
- DAP1;GAP modifying protein 1;GAP-modifying protein 1;GMP1;OFC10;PIC1;SENP2;sentrin;small ubiquitin-related modifier 1;SMT3;SMT3 homolog 3;SMT3 suppressor of mif two 3 homolog 1;SMT3C;SMT3H3;ubiquitin-homology domain protein PIC1;ubiquitin-like protein SMT3C;ubiquitin-like protein UBL1;UBL1
- Extra Details:
- This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.
- Shipping Conditions:
- Blue Ice








