POU2F2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21297
Additional Names:: Oct-2|OCT2|OTF2|POU2F2
Application:: ELISA, WB
Molecular Weight:: 60-75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: VTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Uniprot:: P09086
Synonyms:: homeobox protein;lymphoid-restricted immunoglobulin octamer-binding protein NF-A2;Oct-2;OCT2;octamer-binding protein 2;octamer-binding transcription factor 2;OTF2;POU domain, class 2, transcription factor 2
Extra Details:: The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5'-ATTTGCAT-3', a common transcription factor binding site in immunoglobulin gene promoters. Several transcript variants encoding different isoforms have been found for this gene.