CMTM6 Rabbit monoclonal antibody

Size

POA

SKU:: A21292
Additional Names:: CKLFSF6|CMTM6|PRO2219
Application:: ELISA, WB
Molecular Weight:: 20-22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
Uniprot:: Q9NX76
Synonyms:: chemokine-like factor super family 6;chemokine-like factor superfamily 6;chemokine-like factor superfamily member 6;CKLF-like MARVEL transmembrane domain-containing protein 6;CKLFSF6;PRO2219
Extra Details:: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.