Human IgG (Fc) Rabbit monoclonal antibody

Size

POA

SKU:: A21291
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 50-55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Uniprot:: P01857, P01859, P01860, P01861
Synonyms:: HDC;Heavy chain disease protein;Ig gamma-1 chain C region;Ig gamma-1 chain C region EU;Ig gamma-1 chain C region KOL;Ig gamma-1 chain C region NIE;Ig gamma-2 chain C region;Ig gamma-2 chain C region DOT;Ig gamma-2 chain C region TIL;Ig gamma-2 chain C region ZIE;Ig gamma-3 chain C region;Ig gamma-4 chain C region
Extra Details:: Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.

Shipping Conditions:: Blue Ice