A21278
COR28 Rabbit polyclonal antibody
Size
POA
- SKU:
- A21278
- Additional Names:
- COR28|F17I5_170|F17I5.170
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Plant
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Plant
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SKLDECTAWTNEKHNSYLDYLESSFVRQLYSLLGGGTQRLSRTRDVQSNSHKSADQFTVLQNGCWQKVNFGKKQSCLETSSEFRFHRNSLRNKPENSNGNYTMGTTVQGDVLCHDETKHSE
- Uniprot:
- Q8L983
- Synonyms:
- AT4G33980;F17I5_170;F17I5.170;uncharacterized protein
- Extra Details:
- Light and temperature are two key environmental signals that profoundly affect plant growth and development, COR28 and COR27 are negative regulators of freezing tolerance but positive regulators of flowering. They are involved in central circadian clock regulation and in flowering promotion, by binding to the chromatin of clock-associated evening genes TOC1, PRR5, ELF4 and cold-responsive genes in order to repress their transcription. And also are direct targets of CCA1, which represses their transcription via chromatin binding.
- Shipping Conditions:
- Blue Ice